Lineage for d1g4yb_ (1g4y B:)
- Root: SCOPe 2.02
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) 
Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
oligomeric transmembrane alpha-helical proteinSuperfamily f.15.1: Small-conductance potassium channel [81327] (1 family) 
Family f.15.1.1: Small-conductance potassium channel [81326] (3 proteins) Protein Small-conductance potassium channel [64528] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (2 PDB entries) 
Domain d1g4yb_: 1g4y B: [60251]
Other proteins in same PDB: d1g4yr_
gating domain in complex with calmodulin
complexed with ca, so4
Details for d1g4yb_
PDB Entry: 1g4y (more details), 1.6 Å
PDB Description: 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin
PDB Compounds: (B:) calcium-activated potassium channel rsk2SCOPe Domain Sequences for d1g4yb_:
Sequence, based on SEQRES records: (download)
>d1g4yb_ f.15.1.1 (B:) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktqlehhhhh
Sequence, based on observed residues (ATOM records): (download)
>d1g4yb_ f.15.1.1 (B:) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktqlhhhhh
SCOPe Domain Coordinates for d1g4yb_:
Click to download the PDB-style file with coordinates for d1g4yb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g4yb_:
- d1g4yb_ first appeared in SCOP 1.57
- d1g4yb_ appears in SCOPe 2.01
- d1g4yb_ appears in SCOPe 2.03
- d1g4yb_ appears in the current release, SCOPe 2.08, called d1g4yb1
View in 3D
