![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.15: Small-conductance potassium channel [81328] (1 superfamily) oligomeric transmembrane alpha-helical protein |
![]() | Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) ![]() |
![]() | Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein) |
![]() | Protein Small-conductance potassium channel [64528] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries) |
![]() | Domain d1g4yb1: 1g4y B:413-488 [60251] Other proteins in same PDB: d1g4yb2, d1g4yr_ gating domain in complex with calmodulin complexed with ca, so4 |
PDB Entry: 1g4y (more details), 1.6 Å
SCOPe Domain Sequences for d1g4yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g4yb1 f.15.1.1 (B:413-488) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk lndqantlvdlaktql
Timeline for d1g4yb1: