Lineage for d1g4yb1 (1g4y B:413-488)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023833Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 3023834Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) (S)
  5. 3023835Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)
  6. 3023836Protein Small-conductance potassium channel [64528] (2 species)
  7. 3023840Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)
  8. 3023845Domain d1g4yb1: 1g4y B:413-488 [60251]
    Other proteins in same PDB: d1g4yb2, d1g4yr_
    gating domain in complex with calmodulin
    complexed with ca, so4

Details for d1g4yb1

PDB Entry: 1g4y (more details), 1.6 Å

PDB Description: 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin
PDB Compounds: (B:) calcium-activated potassium channel rsk2

SCOPe Domain Sequences for d1g4yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4yb1 f.15.1.1 (B:413-488) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktql

SCOPe Domain Coordinates for d1g4yb1:

Click to download the PDB-style file with coordinates for d1g4yb1.
(The format of our PDB-style files is described here.)

Timeline for d1g4yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4yb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1g4yr_