Lineage for d1g4yb_ (1g4y B:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 88003Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins)
  6. 88025Protein Small conductance potassium channel [64528] (1 species)
  7. 88026Species Rat (Rattus norvegicus) [TaxId:10116] [64529] (1 PDB entry)
  8. 88027Domain d1g4yb_: 1g4y B: [60251]
    Other proteins in same PDB: d1g4yr_

Details for d1g4yb_

PDB Entry: 1g4y (more details), 1.6 Å

PDB Description: 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin

SCOP Domain Sequences for d1g4yb_:

Sequence, based on SEQRES records: (download)

>d1g4yb_ f.2.1.11 (B:) Small conductance potassium channel {Rat (Rattus norvegicus)}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktqlehhhhh

Sequence, based on observed residues (ATOM records): (download)

>d1g4yb_ f.2.1.11 (B:) Small conductance potassium channel {Rat (Rattus norvegicus)}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktqlhhhhh

SCOP Domain Coordinates for d1g4yb_:

Click to download the PDB-style file with coordinates for d1g4yb_.
(The format of our PDB-style files is described here.)

Timeline for d1g4yb_: