PDB entry 3sjq

View 3sjq on RCSB PDB site
Description: Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
Class: metal binding protein
Keywords: protein-protein complex, EF hand, calmodulin, calcium binding, METAL BINDING PROTEIN
Deposited on 2011-06-21, released 2012-05-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Calm1, Calm, Cam, Cam1, Calm2, Cam2, Camb, Calm3, Cam3, Camc
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calmodulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Calm1, Calm, Cam, Cam1, Calm2, Cam2, Camb, Calm3, Cam3, Camc
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Small conductance calcium-activated potassium channel protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: KCNN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70604 (Start-78)
      • variant (51-53)
      • expression tag (79-81)
    Domains in SCOPe 2.02: d3sjqc_
  • Chain 'D':
    Compound: Small conductance calcium-activated potassium channel protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: KCNN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70604 (Start-78)
      • variant (51-53)
      • expression tag (79-80)
    Domains in SCOPe 2.02: d3sjqd_
  • Heterogens: CA, PHU, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sjqC (C:)
    mdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkm
    eqrklndqantlvdlaktqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sjqC (C:)
    tqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeq
    rklndqantlvdlaktqleh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3sjqD (D:)
    mdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkm
    eqrklndqantlvdlaktqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sjqD (D:)
    qltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeqr
    klndqantlvdlaktqle