PDB entry 3sjq
View 3sjq on RCSB PDB site
Description: Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin
Class: metal binding protein
Keywords: protein-protein complex, EF hand, calmodulin, calcium binding, METAL BINDING PROTEIN
Deposited on
2011-06-21, released
2012-05-30
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-05-30, with a file datestamp of
2012-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: calmodulin
Species: Rattus norvegicus [TaxId:10116]
Gene: Calm1, Calm, Cam, Cam1, Calm2, Cam2, Camb, Calm3, Cam3, Camc
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: calmodulin
Species: Rattus norvegicus [TaxId:10116]
Gene: Calm1, Calm, Cam, Cam1, Calm2, Cam2, Camb, Calm3, Cam3, Camc
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Small conductance calcium-activated potassium channel protein 2
Species: Rattus norvegicus [TaxId:10116]
Gene: KCNN2
Database cross-references and differences (RAF-indexed):
- Uniprot P70604 (Start-78)
- variant (51-53)
- expression tag (79-81)
Domains in SCOPe 2.02: d3sjqc_ - Chain 'D':
Compound: Small conductance calcium-activated potassium channel protein 2
Species: Rattus norvegicus [TaxId:10116]
Gene: KCNN2
Database cross-references and differences (RAF-indexed):
- Uniprot P70604 (Start-78)
- variant (51-53)
- expression tag (79-80)
Domains in SCOPe 2.02: d3sjqd_ - Heterogens: CA, PHU, GOL, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>3sjqC (C:)
mdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkm
eqrklndqantlvdlaktqlehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3sjqC (C:)
tqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeq
rklndqantlvdlaktqleh
- Chain 'D':
Sequence, based on SEQRES records: (download)
>3sjqD (D:)
mdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkm
eqrklndqantlvdlaktqlehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3sjqD (D:)
qltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeqr
klndqantlvdlaktqle