SCOPe 2.08: Domain d3sjqc1: 3sjq C:414-490

Lineage for d3sjqc1 (3sjq C:414-490)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family)

5. Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)

6. Protein Small-conductance potassium channel [64528] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)

8. Domain d3sjqc1: 3sjq C:414-490 [195261]
   Other proteins in same PDB: d3sjqa_, d3sjqb_, d3sjqc2, d3sjqd2
   automated match to d1g4yb_
   complexed with ca, gol, phu, so4

Details for d3sjqc1

PDB Entry: 3sjq, 1.9 Å

PDB Description: Crystal structure of a small conductance potassium channel splice variant complexed with calcium-calmodulin

PDB Compounds: (C:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d3sjqc1:

Sequence; same for both SEQRES and ATOM records:

>d3sjqc1 f.15.1.1 (C:414-490) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqarklrsvkmeq
rklndqantlvdlaktq

Timeline for d3sjqc1:

• d3sjqc1 first appeared in SCOPe 2.02, called d3sjqc_
  
• d3sjqc1 appears in SCOPe 2.07