Lineage for d1ezfa_ (1ezf A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010672Family a.128.1.2: Squalene synthase [48580] (2 protein domains)
    automatically mapped to Pfam PF00494
  6. 2010673Protein Squalene synthase [48581] (1 species)
    synonym: Farnesyl diphosphate farnesyltransferase
  7. 2010674Species Human (Homo sapiens) [TaxId:9606] [48582] (1 PDB entry)
  8. 2010675Domain d1ezfa_: 1ezf A: [19440]
    complexed with in0

Details for d1ezfa_

PDB Entry: 1ezf (more details), 2.15 Å

PDB Description: crystal structure of human squalene synthase
PDB Compounds: (A:) farnesyl-diphosphate farnesyltransferase

SCOPe Domain Sequences for d1ezfa_:

Sequence, based on SEQRES records: (download)

>d1ezfa_ a.128.1.2 (A:) Squalene synthase {Human (Homo sapiens) [TaxId: 9606]}
nslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpll
hnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmaef
ldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktnii
rdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvityl
srlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpavkai
iyqymeeiyhripdsdpsssktrqiistirtqn

Sequence, based on observed residues (ATOM records): (download)

>d1ezfa_ a.128.1.2 (A:) Squalene synthase {Human (Homo sapiens) [TaxId: 9606]}
nslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpll
hnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmaef
ldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktnii
rdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvityl
srlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkidatnmpavkaiiyqymeeiyh
ripdsdpsssktrqiistirtqn

SCOPe Domain Coordinates for d1ezfa_:

Click to download the PDB-style file with coordinates for d1ezfa_.
(The format of our PDB-style files is described here.)

Timeline for d1ezfa_: