PDB entry 1ezf

View 1ezf on RCSB PDB site
Description: crystal structure of human squalene synthase
Class: transferase
Keywords: isoprenoid synthase fold, all alpha-helix, TRANSFERASE
Deposited on 2000-05-10, released 2000-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl-diphosphate farnesyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37268 (Start-339)
      • engineered (7)
    Domains in SCOPe 2.07: d1ezfa_
  • Chain 'B':
    Compound: farnesyl-diphosphate farnesyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37268 (Start-339)
      • engineered (3)
      • engineered (7)
    Domains in SCOPe 2.07: d1ezfb_
  • Chain 'C':
    Compound: farnesyl-diphosphate farnesyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37268 (Start-339)
      • engineered (7)
    Domains in SCOPe 2.07: d1ezfc_
  • Heterogens: IN0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ezfA (A:)
    mdrnslsnslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisv
    ekkvpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrm
    gigmaefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglf
    lqktniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhi
    pdvitylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatn
    mpavkaiiyqymeeiyhripdsdpsssktrqiistirtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezfA (A:)
    nslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpll
    hnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmaef
    ldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktnii
    rdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvityl
    srlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkidatnmpavkaiiyqymeeiyh
    ripdsdpsssktrqiistirtqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ezfB (B:)
    mdrnslsnslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisv
    ekkvpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrm
    gigmaefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglf
    lqktniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhi
    pdvitylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatn
    mpavkaiiyqymeeiyhripdsdpsssktrqiistirtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezfB (B:)
    nslsnslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekk
    vpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgig
    maefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqk
    tniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdv
    itylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavatnmpavkaiiyqymeeiy
    hripdsdpsssktrqiistirtqn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ezfC (C:)
    mdrnslsnslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisv
    ekkvpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrm
    gigmaefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglf
    lqktniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhi
    pdvitylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatn
    mpavkaiiyqymeeiyhripdsdpsssktrqiistirtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezfC (C:)
    nslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpll
    hnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmaef
    ldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktnii
    rdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvityl
    srlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavatnmpavkaiiyqymeeiyhrip
    dsdpsssktrqiistirtqn