SCOPe 2.08: Domain d4hx2c_: 4hx2 C:

Lineage for d4hx2c_ (4hx2 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (15 proteins)

6. Protein automated matches [190073] (16 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [186887] (8 PDB entries)

8. Domain d4hx2c_: 4hx2 C: [192838]
   Other proteins in same PDB: d4hx2b1, d4hx2b2, d4hx2d_
   automated match to d3qtla_
   complexed with 1ax, act, ca, cac, cl, gol, ipa, k, po4, zn

Details for d4hx2c_

PDB Entry: 4hx2, 2.25 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with bacillus licheniformis subtilisin

PDB Compounds: (C:) KerA

SCOPe Domain Sequences for d4hx2c_:

Sequence; same for both SEQRES and ATOM records:

>d4hx2c_ c.41.1.1 (C:) automated matches {Bacillus licheniformis [TaxId: 1402]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgssgntntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

Timeline for d4hx2c_:

• d4hx2c_ first appeared in SCOPe 2.02
  
• d4hx2c_ appears in SCOPe 2.07