SCOPe 2.08: Domain d4hx2b1: 4hx2 B:1-113

Lineage for d4hx2b1 (4hx2 B:1-113)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families)

5. Family d.84.1.0: automated matches [193339] (1 protein)
   not a true family

6. Protein automated matches [193340] (2 species)
   not a true protein

7. Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries)

8. Domain d4hx2b1: 4hx2 B:1-113 [234722]
   Other proteins in same PDB: d4hx2a_, d4hx2b2, d4hx2c_
   automated match to d4hx3d_
   complexed with 1ax, act, ca, cac, cl, gol, ipa, k, po4, zn

Details for d4hx2b1

PDB Entry: 4hx2, 2.25 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with bacillus licheniformis subtilisin

PDB Compounds: (B:) Neutral proteinase inhibitor ScNPI

SCOPe Domain Sequences for d4hx2b1:

Sequence; same for both SEQRES and ATOM records:

>d4hx2b1 d.84.1.0 (B:1-113) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

Timeline for d4hx2b1:

• d4hx2b1 first appeared in SCOPe 2.03, called d4hx2b_
  
• d4hx2b1 appears in SCOPe 2.07