Lineage for d4hx2b1 (4hx2 B:1-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962415Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
    alpha+beta sandwich
  4. 2962416Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) (S)
  5. 2962426Family d.84.1.0: automated matches [193339] (1 protein)
    not a true family
  6. 2962427Protein automated matches [193340] (2 species)
    not a true protein
  7. 2962428Species Streptomyces caespitosus [TaxId:53502] [193341] (3 PDB entries)
  8. 2962430Domain d4hx2b1: 4hx2 B:1-113 [234722]
    Other proteins in same PDB: d4hx2a_, d4hx2b2, d4hx2c_
    automated match to d4hx3d_
    complexed with 1ax, act, ca, cac, cl, gol, ipa, k, po4, zn

Details for d4hx2b1

PDB Entry: 4hx2 (more details), 2.25 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with bacillus licheniformis subtilisin
PDB Compounds: (B:) Neutral proteinase inhibitor ScNPI

SCOPe Domain Sequences for d4hx2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hx2b1 d.84.1.0 (B:1-113) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

SCOPe Domain Coordinates for d4hx2b1:

Click to download the PDB-style file with coordinates for d4hx2b1.
(The format of our PDB-style files is described here.)

Timeline for d4hx2b1: