Lineage for d4hx2a_ (4hx2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873644Protein automated matches [190073] (16 species)
    not a true protein
  7. 2873682Species Bacillus licheniformis [TaxId:1402] [186887] (8 PDB entries)
  8. 2873690Domain d4hx2a_: 4hx2 A: [192569]
    Other proteins in same PDB: d4hx2b1, d4hx2b2, d4hx2d_
    automated match to d3qtla_
    complexed with 1ax, act, ca, cac, cl, gol, ipa, k, po4, zn

Details for d4hx2a_

PDB Entry: 4hx2 (more details), 2.25 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with bacillus licheniformis subtilisin
PDB Compounds: (A:) KerA

SCOPe Domain Sequences for d4hx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hx2a_ c.41.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgssgntntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

SCOPe Domain Coordinates for d4hx2a_:

Click to download the PDB-style file with coordinates for d4hx2a_.
(The format of our PDB-style files is described here.)

Timeline for d4hx2a_: