Lineage for d3umsa2 (3ums A:6-60,A:182-354)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867892Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 2867917Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries)
  8. 2867919Domain d3umsa2: 3ums A:6-60,A:182-354 [192181]
    Other proteins in same PDB: d3umsa1
    complexed with cl, gdp, so4; mutant
    has additional subdomain(s) that are not in the common domain

Details for d3umsa2

PDB Entry: 3ums (more details), 2.34 Å

PDB Description: Crystal structure of the G202A mutant of human G-alpha-i1
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i) subunit alpha-1

SCOPe Domain Sequences for d3umsa2:

Sequence, based on SEQRES records: (download)

>d3umsa2 c.37.1.8 (A:6-60,A:182-354) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
saedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgiv
ethftfkdlhfkmfdvagqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhe
smklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqc
qfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

Sequence, based on observed residues (ATOM records): (download)

>d3umsa2 c.37.1.8 (A:6-60,A:182-354) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
saedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgiv
ethftfkdlhfkmfdvafegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnk
wftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtk
eiythftcatdtknvqfvfdavtdviiknnlkdcglf

SCOPe Domain Coordinates for d3umsa2:

Click to download the PDB-style file with coordinates for d3umsa2.
(The format of our PDB-style files is described here.)

Timeline for d3umsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3umsa1