Lineage for d1myo__ (1myo -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) 
Protein Myotrophin [48419] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48420] (2 PDB entries) 
Domain d1myo__: 1myo - [19174]
Details for d1myo__
PDB Entry: 1myo (more details)
PDB Description: solution structure of myotrophin, nmr, 44 structures
SCOP Domain Sequences for d1myo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1myo__ a.118.2.1 (-) Myotrophin {Rat (Rattus norvegicus)}
mcdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgad
inapdkhhitpllsavyeghvscvklllskgadktvkgpdgltaleatdnqaikallq
SCOP Domain Coordinates for d1myo__:
Click to download the PDB-style file with coordinates for d1myo__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1myo__:
- d1myo__ appears in SCOP 1.57
- d1myo__ appears in the current release, SCOPe 2.08, called d1myoa_
View in 3D