SCOPe 2.08: Domain d1myoa_: 1myo A:

Lineage for d1myoa_ (1myo A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Myotrophin [48419] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48420] (2 PDB entries)

8. Domain d1myoa_: 1myo A: [19174]
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1myoa_

PDB Entry: 1myo

PDB Description: solution structure of myotrophin, nmr, 44 structures

PDB Compounds: (A:) myotrophin

SCOPe Domain Sequences for d1myoa_:

Sequence; same for both SEQRES and ATOM records:

>d1myoa_ d.211.1.1 (A:) Myotrophin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mcdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgad
inapdkhhitpllsavyeghvscvklllskgadktvkgpdgltaleatdnqaikallq

Timeline for d1myoa_:

• d1myoa_ first appeared (with stable ids) in SCOP 1.55, called d1myo__
  
• d1myoa_ appears in SCOPe 2.07