Lineage for d1dc2a_ (1dc2 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) 
Protein Cell cycle inhibitor p16ink4A [48414] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries) 
Domain d1dc2a_: 1dc2 A: [19168]
Details for d1dc2a_
PDB Entry: 1dc2 (more details)
PDB Description: solution nmr structure of tumor suppressor p16ink4a, 20 structures
SCOP Domain Sequences for d1dc2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dc2a_ a.118.2.1 (A:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens)}
mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
lghrdvarylraaaggtrgsnharidaaegpsdipd
SCOP Domain Coordinates for d1dc2a_:
Click to download the PDB-style file with coordinates for d1dc2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dc2a_:
- d1dc2a_ appears in SCOP 1.57
- d1dc2a_ appears in the current release, SCOPe 2.08
View in 3D