Lineage for d1dc2a_ (1dc2 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
  6. Protein Cell cycle inhibitor p16ink4A [48414] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)
  8. Domain d1dc2a_: 1dc2 A: [19168]

Details for d1dc2a_

PDB Entry: 1dc2 (more details)

PDB Description: solution nmr structure of tumor suppressor p16ink4a, 20 structures
PDB Compounds: (A:) cyclin-dependent kinase 4 inhibitor a (p16ink4a)

SCOPe Domain Sequences for d1dc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc2a_ d.211.1.1 (A:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}
mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
lghrdvarylraaaggtrgsnharidaaegpsdipd

SCOPe Domain Coordinates for d1dc2a_ are not available.

Timeline for d1dc2a_: