Lineage for d1dc2a_ (1dc2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006534Protein Cell cycle inhibitor p16ink4A [48414] (2 species)
  7. 3006535Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)
  8. 3006538Domain d1dc2a_: 1dc2 A: [19168]

Details for d1dc2a_

PDB Entry: 1dc2 (more details)

PDB Description: solution nmr structure of tumor suppressor p16ink4a, 20 structures
PDB Compounds: (A:) cyclin-dependent kinase 4 inhibitor a (p16ink4a)

SCOPe Domain Sequences for d1dc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc2a_ d.211.1.1 (A:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}
mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
lghrdvarylraaaggtrgsnharidaaegpsdipd

SCOPe Domain Coordinates for d1dc2a_:

Click to download the PDB-style file with coordinates for d1dc2a_.
(The format of our PDB-style files is described here.)

Timeline for d1dc2a_: