Lineage for d1geia_ (1gei A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily) Superfamily a.104.1: Cytochrome P450 [48264] (1 family) 
Family a.104.1.1: Cytochrome P450 [48265] (8 proteins) Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species) Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (14 PDB entries) 
Domain d1geia_: 1gei A: [18955]
Details for d1geia_
PDB Entry: 1gei (more details), 1.6 Å
PDB Description: structural characterization of n-butyl-isocyanide complexes of cytochromes p450nor and p450cam
SCOP Domain Sequences for d1geia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1geia_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum)}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
SCOP Domain Coordinates for d1geia_:
Click to download the PDB-style file with coordinates for d1geia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1geia_:
- d1geia_ appears in SCOP 1.57
- d1geia_ appears in the current release, SCOPe 2.08
View in 3D