Lineage for d1geia_ (1gei A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331415Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 2331416Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (25 PDB entries)
    Uniprot P23295
  8. 2331424Domain d1geia_: 1gei A: [18955]
    complexed with hem, nbn

Details for d1geia_

PDB Entry: 1gei (more details), 1.6 Å

PDB Description: structural characterization of n-butyl-isocyanide complexes of cytochromes p450nor and p450cam
PDB Compounds: (A:) cytochrome p450 55a1

SCOPe Domain Sequences for d1geia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1geia_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOPe Domain Coordinates for d1geia_:

Click to download the PDB-style file with coordinates for d1geia_.
(The format of our PDB-style files is described here.)

Timeline for d1geia_: