|  | Class a: All alpha proteins [46456] (138 folds) | 
|  | Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) | 
|  | Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)  | 
|  | Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) | 
|  | Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species) | 
|  | Species Escherichia coli [TaxId:562] [48171] (8 PDB entries) | 
|  | Domain d3r1rb1: 3r1r B:5-221 [18767] Other proteins in same PDB: d3r1ra2, d3r1rb2, d3r1rc2 | 
PDB Entry: 3r1r (more details), 3 Å
SCOP Domain Sequences for d3r1rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r1rb1 a.98.1.1 (B:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d3r1rb1:
|  View in 3D Domains from other chains: (mouse over for more information) d3r1ra1, d3r1ra2, d3r1rc1, d3r1rc2 |