| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
| Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
| Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
| Species Escherichia coli [TaxId:562] [48171] (10 PDB entries) Uniprot Q08698 |
| Domain d3r1rb1: 3r1r B:5-221 [18767] Other proteins in same PDB: d3r1ra2, d3r1rb2, d3r1rc2 complexed with atp |
PDB Entry: 3r1r (more details), 3 Å
SCOPe Domain Sequences for d3r1rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r1rb1 a.98.1.1 (B:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d3r1rb1:
View in 3DDomains from other chains: (mouse over for more information) d3r1ra1, d3r1ra2, d3r1rc1, d3r1rc2 |