Lineage for d4a1wd1 (4a1w D:1-196)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021485Protein automated matches [190236] (3 species)
    not a true protein
  7. 3021486Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)
  8. 3021533Domain d4a1wd1: 4a1w D:1-196 [186695]
    Other proteins in same PDB: d4a1wa2, d4a1wb2, d4a1wd2
    automated match to d1g5ja_

Details for d4a1wd1

PDB Entry: 4a1w (more details), 2.5 Å

PDB Description: crystal structure of alpha-beta foldamer 4c in complex with bcl-xl
PDB Compounds: (D:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4a1wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a1wd1 f.1.4.1 (D:1-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelyg

SCOPe Domain Coordinates for d4a1wd1:

Click to download the PDB-style file with coordinates for d4a1wd1.
(The format of our PDB-style files is described here.)

Timeline for d4a1wd1: