SCOPe 2.07: Domain d3twrd1: 3twr D:488-644

Lineage for d3twrd1 (3twr D:488-644)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)

8. Domain d3twrd1: 3twr D:488-644 [185976]
   Other proteins in same PDB: d3twrd2
   automated match to d1awcb_
   complexed with pe8, so4

Details for d3twrd1

PDB Entry: 3twr, 1.55 Å

PDB Description: Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human 3BP2

PDB Compounds: (D:) tankyrase-2

SCOPe Domain Sequences for d3twrd1:

Sequence; same for both SEQRES and ATOM records:

>d3twrd1 d.211.1.0 (D:488-644) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllq
hgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyei
cklllqhgadptkknrdgntpldlvkdgdtdiqdllr

Timeline for d3twrd1:

• d3twrd1 first appeared in SCOPe 2.01, called d3twrd_
  
• d3twrd1 appears in SCOPe 2.06
  
• d3twrd1 appears in the current release, SCOPe 2.08