Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.0: automated matches [191667] (1 protein) not a true family |
Protein automated matches [191267] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries) |
Domain d3twrc_: 3twr C: [185975] Other proteins in same PDB: d3twrd2 automated match to d1awcb_ complexed with pe8, so4 |
PDB Entry: 3twr (more details), 1.55 Å
SCOPe Domain Sequences for d3twrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3twrc_ d.211.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gnseadrqlleaakagdvetvkklctvqsvncrdiegrqstplhfaagynrvsvveyllq hgadvhakdkgglvplhnacsyghyevaellvkhgavvnvadlwkftplheaaakgkyei cklllqhgadptkknrdgntpldlvkdgdtdiqdllrg
Timeline for d3twrc_:
View in 3D Domains from other chains: (mouse over for more information) d3twra_, d3twrb_, d3twrd1, d3twrd2 |