Lineage for d1awcb_ (1awc B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612404Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2612444Protein GA bindinig protein (GABP) beta 1 [48407] (1 species)
  7. 2612445Species Mouse (Mus musculus) [TaxId:10090] [48408] (1 PDB entry)
  8. 2612446Domain d1awcb_: 1awc B: [19156]
    Other proteins in same PDB: d1awca_
    protein/DNA complex

Details for d1awcb_

PDB Entry: 1awc (more details), 2.15 Å

PDB Description: mouse gabp alpha/beta domain bound to dna
PDB Compounds: (B:) protein (ga binding protein beta 1)

SCOPe Domain Sequences for d1awcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]}
dlgkklleaaragqddevrilmangapfttdwlgtsplhlaaqyghfsttevllragvsr
dartkvdrtplhmaaseghanivevllkhgadvnakdmlkmtalhwatehnhqevvelli
kygadvhtqskfcktafdisidngnedlaeilq

SCOPe Domain Coordinates for d1awcb_:

Click to download the PDB-style file with coordinates for d1awcb_.
(The format of our PDB-style files is described here.)

Timeline for d1awcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1awca_