![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
![]() | Protein GA bindinig protein (GABP) beta 1 [48407] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [48408] (1 PDB entry) |
![]() | Domain d1awcb_: 1awc B: [19156] Other proteins in same PDB: d1awca_ protein/DNA complex applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 1awc (more details), 2.15 Å
SCOPe Domain Sequences for d1awcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} dlgkklleaaragqddevrilmangapfttdwlgtsplhlaaqyghfsttevllragvsr dartkvdrtplhmaaseghanivevllkhgadvnakdmlkmtalhwatehnhqevvelli kygadvhtqskfcktafdisidngnedlaeilq
Timeline for d1awcb_: