Lineage for d1awca_ (1awc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306859Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2306888Protein GA binding protein (GABP) alpha [46867] (1 species)
  7. 2306889Species Mouse (Mus musculus) [TaxId:10090] [46868] (1 PDB entry)
  8. 2306890Domain d1awca_: 1awc A: [16167]
    Other proteins in same PDB: d1awcb_
    protein/DNA complex

Details for d1awca_

PDB Entry: 1awc (more details), 2.15 Å

PDB Description: mouse gabp alpha/beta domain bound to dna
PDB Compounds: (A:) protein (ga binding protein alpha)

SCOPe Domain Sequences for d1awca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]}
iqlwqfllelltdkdardciswvgdegefklnqpelvaqkwgqrknkptmnyeklsralr
yyydgdmickvqgkrfvykfvcdlktligysaaelnrlvieceqkklarm

SCOPe Domain Coordinates for d1awca_:

Click to download the PDB-style file with coordinates for d1awca_.
(The format of our PDB-style files is described here.)

Timeline for d1awca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1awcb_