Lineage for d1emua_ (1emu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719792Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2719793Protein Axin RGS-homologous domain [48105] (1 species)
  7. 2719794Species Human (Homo sapiens) [TaxId:9606] [48106] (2 PDB entries)
  8. 2719796Domain d1emua_: 1emu A: [18549]
    Complex with a samp repeat from apc; chain B
    complexed with gol

Details for d1emua_

PDB Entry: 1emu (more details), 1.9 Å

PDB Description: structure of the axin rgs-homologous domain in complex with a samp repeat from apc
PDB Compounds: (A:) Axin

SCOPe Domain Sequences for d1emua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emua_ a.91.1.1 (A:) Axin RGS-homologous domain {Human (Homo sapiens) [TaxId: 9606]}
ppylkwaeslhsllddqdgislfrtflkqegcadlldfwfactgfrklepcdsneekrlk
laraiyrkyildnngivsrqtkpatksfikgcimkqlidpamfdqaqteiqatmeentyp
sflksdiyleyt

SCOPe Domain Coordinates for d1emua_:

Click to download the PDB-style file with coordinates for d1emua_.
(The format of our PDB-style files is described here.)

Timeline for d1emua_: