Lineage for d1emua_ (1emu A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily) Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) 
Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (4 proteins) Protein Axin RGS-homologous domain [48105] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48106] (2 PDB entries) 
Domain d1emua_: 1emu A: [18549]
Details for d1emua_
PDB Entry: 1emu (more details), 1.9 Å
PDB Description: structure of the axin rgs-homologous domain in complex with a samp repeat from apc
SCOP Domain Sequences for d1emua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emua_ a.91.1.1 (A:) Axin RGS-homologous domain {Human (Homo sapiens)}
ppylkwaeslhsllddqdgislfrtflkqegcadlldfwfactgfrklepcdsneekrlk
laraiyrkyildnngivsrqtkpatksfikgcimkqlidpamfdqaqteiqatmeentyp
sflksdiyleyt
SCOP Domain Coordinates for d1emua_:
Click to download the PDB-style file with coordinates for d1emua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1emua_:
- d1emua_ appears in SCOP 1.57
- d1emua_ appears in the current release, SCOPe 2.08
View in 3D