PDB entry 1emu

View 1emu on RCSB PDB site
Description: structure of the axin rgs-homologous domain in complex with a samp repeat from apc
Class: signaling protein
Keywords: RGS domain, SIGNALING PROTEIN
Deposited on 2000-03-17, released 2000-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Axin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1emua_
  • Chain 'B':
    Compound: adenomatous polyposis coli protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1emuA (A:)
    ppylkwaeslhsllddqdgislfrtflkqegcadlldfwfactgfrklepcdsneekrlk
    laraiyrkyildnngivsrqtkpatksfikgcimkqlidpamfdqaqteiqatmeentyp
    sflksdiyleyt
    

  • Chain 'B':
    No sequence available.