![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
![]() | Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
![]() | Protein Regulator of G-protein signaling 4, RGS4 [48099] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries) |
![]() | Domain d1agre_: 1agr E: [18538] Other proteins in same PDB: d1agra1, d1agra2, d1agrd1, d1agrd2 complexed with alf, cit, gdp, mg |
PDB Entry: 1agr (more details), 2.8 Å
SCOPe Domain Sequences for d1agre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agre_ a.91.1.1 (E:) Regulator of G-protein signaling 4, RGS4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk srfyldlt
Timeline for d1agre_: