![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries) |
![]() | Domain d1agra1: 1agr A:61-181 [18228] Other proteins in same PDB: d1agra2, d1agrd2, d1agre_, d1agrh_ complexed with alf, cit, gdp, mg |
PDB Entry: 1agr (more details), 2.8 Å
SCOPe Domain Sequences for d1agra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agra1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
Timeline for d1agra1:
![]() Domains from other chains: (mouse over for more information) d1agrd1, d1agrd2, d1agre_, d1agrh_ |