SCOPe 2.07: Domain d1agra1: 1agr A:61-181

Lineage for d1agra1 (1agr A:61-181)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)

8. Domain d1agra1: 1agr A:61-181 [18228]
   Other proteins in same PDB: d1agra2, d1agrd2, d1agre_, d1agrh_
   complexed with alf, cit, gdp, mg

Details for d1agra1

PDB Entry: 1agr, 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4

PDB Compounds: (A:) guanine nucleotide-binding protein g(I)

SCOPe Domain Sequences for d1agra1:

Sequence; same for both SEQRES and ATOM records:

>d1agra1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d1agra1:

• d1agra1 first appeared (with stable ids) in SCOP 1.55
  
• d1agra1 appears in SCOPe 2.06
  
• d1agra1 appears in the current release, SCOPe 2.08