PDB entry 1agr

View 1agr on RCSB PDB site
Description: complex of alf4-activated gi-alpha-1 with rgs4
Class: complex (signal transduction/regulator)
Keywords: gi-alpha-1, hydrolase, signal transduction, rgs4, complex (signal transduction/regulator), GTP-binding, gtpase activating protein
Deposited on 1997-03-25, released 1997-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide-binding protein g(I)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agra1, d1agra2
  • Chain 'D':
    Compound: guanine nucleotide-binding protein g(I)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agrd1, d1agrd2
  • Chain 'E':
    Compound: rgs4
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agre_
  • Chain 'H':
    Compound: rgs4
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1agrh_
  • Heterogens: MG, ALF, GDP, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1agrA (A:)
    gctlsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagy
    seeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmta
    elagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
    tgivethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemn
    rmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaa
    yiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agrA (A:)
    lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagysee
    eckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmtaela
    gvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkttgi
    vethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh
    esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq
    cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1agrD (D:)
    gctlsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagy
    seeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmta
    elagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
    tgivethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemn
    rmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaa
    yiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agrD (D:)
    aaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagyseeeckqyk
    avvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmtaelagvikrl
    wkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkttgivethft
    fkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklf
    dsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedl
    nkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1agrE (E:)
    mckglaglpasclrsakdmkhrlgfllqksdscehssshskkdkvvtcqrvsqeevkkwa
    eslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspkakkiynefis
    vqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflksrfyldltnp
    sscgaekqkgakssadctslvpqca
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agrE (E:)
    vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
    akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
    srfyldlt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1agrH (H:)
    mckglaglpasclrsakdmkhrlgfllqksdscehssshskkdkvvtcqrvsqeevkkwa
    eslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspkakkiynefis
    vqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflksrfyldltnp
    sscgaekqkgakssadctslvpqca
    

    Sequence, based on observed residues (ATOM records): (download)
    >1agrH (H:)
    aeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspkakkiynefi
    svqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflksrfyl