Lineage for d1by1a_ (1by1 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.87: DBL homology domain [48064] (1 superfamily) Superfamily a.87.1: DBL homology domain [48065] (1 family) 
Family a.87.1.1: DBL homology domain [48066] (4 proteins) 
Protein beta-pix [48069] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48070] (1 PDB entry) 
Domain d1by1a_: 1by1 A: [18515]
Details for d1by1a_
PDB Entry: 1by1 (more details)
PDB Description: dbl homology domain from beta-pix
SCOP Domain Sequences for d1by1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens)}
mkgfdttainksyynvvlqnileteneyskelqtvlstylrplqtseklssanisylmgn
leeicsfqqmlvqsleectklpeaqqrvggcflnlmpqmktlyltycanhpsavnvlteh
seelgefmetkgasspgilvlttglskpfmrldkyptllkelerhmedyhtdrqdiqksm
aafknlsaqcqevrkrkelelqilteair
SCOP Domain Coordinates for d1by1a_:
Click to download the PDB-style file with coordinates for d1by1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1by1a_:
- d1by1a_ appears in SCOP 1.57
- d1by1a_ appears in the current release, SCOPe 2.08, called d1by1a1
View in 3D