Lineage for d1by1a1 (1by1 A:2-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719562Protein beta-pix [48069] (1 species)
  7. 2719563Species Human (Homo sapiens) [TaxId:9606] [48070] (1 PDB entry)
  8. 2719564Domain d1by1a1: 1by1 A:2-209 [18515]
    Other proteins in same PDB: d1by1a2

Details for d1by1a1

PDB Entry: 1by1 (more details)

PDB Description: dbl homology domain from beta-pix
PDB Compounds: (A:) protein (pix)

SCOPe Domain Sequences for d1by1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1by1a1 a.87.1.1 (A:2-209) beta-pix {Human (Homo sapiens) [TaxId: 9606]}
kgfdttainksyynvvlqnileteneyskelqtvlstylrplqtseklssanisylmgnl
eeicsfqqmlvqsleectklpeaqqrvggcflnlmpqmktlyltycanhpsavnvltehs
eelgefmetkgasspgilvlttglskpfmrldkyptllkelerhmedyhtdrqdiqksma
afknlsaqcqevrkrkelelqilteair

SCOPe Domain Coordinates for d1by1a1:

Click to download the PDB-style file with coordinates for d1by1a1.
(The format of our PDB-style files is described here.)

Timeline for d1by1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1by1a2