SCOPe 2.07: Domain d1f5td2: 1f5t D:4065-4121

Lineage for d1f5td2 (1f5t D:4065-4121)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
   Uniprot P33120

8. Domain d1f5td2: 1f5t D:4065-4121 [18412]
   Other proteins in same PDB: d1f5ta1, d1f5tb1, d1f5tc1, d1f5td1
   protein/DNA complex; complexed with ni; mutant

Details for d1f5td2

PDB Entry: 1f5t, 3 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence

PDB Compounds: (D:) diphtheria toxin repressor

SCOPe Domain Sequences for d1f5td2:

Sequence; same for both SEQRES and ATOM records:

>d1f5td2 a.76.1.1 (D:4065-4121) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk

Timeline for d1f5td2:

• d1f5td2 first appeared (with stable ids) in SCOP 1.55
  
• d1f5td2 appears in SCOPe 2.06
  
• d1f5td2 appears in the current release, SCOPe 2.08