Class a: All alpha proteins [46456] (290 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) automatically mapped to Pfam PF02742 |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries) Uniprot P33120 |
Domain d1f5td2: 1f5t D:4065-4121 [18412] Other proteins in same PDB: d1f5ta1, d1f5tb1, d1f5tc1, d1f5td1 protein/DNA complex; complexed with ni; mutant |
PDB Entry: 1f5t (more details), 3 Å
SCOPe Domain Sequences for d1f5td2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5td2 a.76.1.1 (D:4065-4121) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk
Timeline for d1f5td2: