Lineage for d1f5tb2 (1f5t B:2065-2121)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331932Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2331933Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2331934Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2331935Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 2331936Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
    Uniprot P33120
  8. 2331956Domain d1f5tb2: 1f5t B:2065-2121 [18410]
    Other proteins in same PDB: d1f5ta1, d1f5tb1, d1f5tc1, d1f5td1
    protein/DNA complex; complexed with ni; mutant

Details for d1f5tb2

PDB Entry: 1f5t (more details), 3 Å

PDB Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence
PDB Compounds: (B:) diphtheria toxin repressor

SCOPe Domain Sequences for d1f5tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5tb2 a.76.1.1 (B:2065-2121) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk

SCOPe Domain Coordinates for d1f5tb2:

Click to download the PDB-style file with coordinates for d1f5tb2.
(The format of our PDB-style files is described here.)

Timeline for d1f5tb2: