PDB entry 1f5t

View 1f5t on RCSB PDB site
Description: diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence
Class: transcription/DNA
Keywords: iron-regulated repressor, DNA-protein complex, helix-turn-helix motif, transcription regulator, diphtheria tox repressor, DNA-binding regulatory protein, TRANSCRIPTION/DNA COMPLEX
Deposited on 2000-06-15, released 2000-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.245
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120
      • engineered (101)
    Domains in SCOPe 2.07: d1f5ta1, d1f5ta2
  • Chain 'B':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120
      • engineered (101)
    Domains in SCOPe 2.07: d1f5tb1, d1f5tb2
  • Chain 'C':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120
      • engineered (101)
    Domains in SCOPe 2.07: d1f5tc1, d1f5tc2
  • Chain 'D':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120 (Start-120)
      • engineered (101)
    Domains in SCOPe 2.07: d1f5td1, d1f5td2
  • Chain 'E':
    Compound: 43mer DNA containing dxtr consensus binding sequence
  • Chain 'F':
    Compound: 43mer DNA containing dxtr consensus binding sequence
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f5tA (A:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f5tA (A:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f5tB (B:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f5tB (B:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f5tC (C:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f5tC (C:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f5tD (D:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f5tD (D:)
    kdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrs
    lqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.