Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (12 species) not a true protein |
Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries) |
Domain d3pwqb1: 3pwq B:2-248 [184044] Other proteins in same PDB: d3pwqa2, d3pwqb2, d3pwqe2, d3pwqg2, d3pwqi2, d3pwqj2, d3pwqr2 automated match to d1otka_ |
PDB Entry: 3pwq (more details), 2.65 Å
SCOPe Domain Sequences for d3pwqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwqb1 a.25.1.2 (B:2-248) automated matches {Escherichia coli [TaxId: 511145]} nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylqr vlpgqqw
Timeline for d3pwqb1: