![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
![]() | Protein automated matches [190435] (12 species) not a true protein |
![]() | Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries) |
![]() | Domain d3pwqj1: 3pwq J:2-238 [184048] Other proteins in same PDB: d3pwqa2, d3pwqb2, d3pwqe2, d3pwqg2, d3pwqi2, d3pwqj2, d3pwqr2 automated match to d1otka_ |
PDB Entry: 3pwq (more details), 2.65 Å
SCOPe Domain Sequences for d3pwqj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwqj1 a.25.1.2 (J:2-238) automated matches {Escherichia coli [TaxId: 511145]} nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqy
Timeline for d3pwqj1: