SCOPe 2.08: Domain d1guxb_: 1gux B:

Lineage for d1guxb_ (1gux B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)

8. Domain d1guxb_: 1gux B: [18389]
   domains A and B
   has additional insertions and/or extensions that are not grouped together

Details for d1guxb_

PDB Entry: 1gux, 1.85 Å

PDB Description: rb pocket bound to e7 lxcxe motif

PDB Compounds: (B:) retinoblastoma protein

SCOPe Domain Sequences for d1guxb_:

Sequence; same for both SEQRES and ATOM records:

>d1guxb_ a.74.1.3 (B:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
tslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqim
mcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqrl
ktnilqyastrpptlspiphi

Timeline for d1guxb_:

• d1guxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1guxb_ appears in SCOPe 2.07