PDB entry 1gux

View 1gux on RCSB PDB site
Description: rb pocket bound to e7 lxcxe motif
Class: complex (transcription reg/peptide)
Keywords: complex (transcription regulation/peptide), tumor suppressor protein, retinoblastoma, complex (transcription reg/peptide) complex
Deposited on 1997-11-15, released 1998-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.218
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinoblastoma protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1guxa_
  • Chain 'B':
    Compound: retinoblastoma protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1guxb_
  • Chain 'E':
    Compound: oncoprotein
    Species: Human papillomavirus [TaxId:10566]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUX (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1guxA (A:)
    htpvrtvmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfa
    kavgqgcveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacal
    evvmatysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhle
    rcehrimeslawlsdsplfdlikqskdregptdhlesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guxA (A:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcv
    eigsqryklgvrlyyrvmesmlksenfskllndnifhmsllacalevvmatysfpwilnv
    lnlkafdfykviesfikaegnltremikhlercehrimeslawlsdsplfdlikqsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1guxB (B:)
    fqtqkplkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelm
    rdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivf
    ynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guxB (B:)
    tslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqim
    mcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqrl
    ktnilqyastrpptlspiphi
    

  • Chain 'E':
    No sequence available.