Lineage for d1guxb_ (1gux B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily) Superfamily a.74.1: Cyclin-like [47954] (3 families) 
Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) Protein Retinoblastoma tumor suppressor domains [47970] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47971] (2 PDB entries) 
Domain d1guxb_: 1gux B: [18389]
Details for d1guxb_
PDB Entry: 1gux (more details), 1.85 Å
PDB Description: rb pocket bound to e7 lxcxe motif
SCOP Domain Sequences for d1guxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1guxb_ a.74.1.3 (B:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
tslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqim
mcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqrl
ktnilqyastrpptlspiphi
SCOP Domain Coordinates for d1guxb_:
Click to download the PDB-style file with coordinates for d1guxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1guxb_:
- d1guxb_ appears in SCOP 1.57
- d1guxb_ appears in the current release, SCOPe 2.08
View in 3D
