![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
![]() | Domain d3nzwz_: 3nzw Z: [182694] Other proteins in same PDB: d3nzw1_, d3nzwa_, d3nzwc2, d3nzwe_, d3nzwf_, d3nzwi_, d3nzwj_, d3nzwm_, d3nzwo_, d3nzwq2, d3nzws_, d3nzwt_, d3nzww_, d3nzwx_ automated match to d1g0ul_ complexed with mes |
PDB Entry: 3nzw (more details), 2.5 Å
SCOPe Domain Sequences for d3nzwz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nzwz_ d.153.1.4 (Z:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
Timeline for d3nzwz_:
![]() Domains from other chains: (mouse over for more information) d3nzw1_, d3nzw2_, d3nzwa_, d3nzwb_, d3nzwc1, d3nzwc2, d3nzwd_, d3nzwe_, d3nzwf_, d3nzwg_, d3nzwh_, d3nzwi_, d3nzwj_, d3nzwk_, d3nzwl_, d3nzwm_, d3nzwn_, d3nzwo_, d3nzwp_, d3nzwq1, d3nzwq2, d3nzwr_, d3nzws_, d3nzwt_, d3nzwu_, d3nzwv_, d3nzww_, d3nzwx_, d3nzwy_ |