Lineage for d3nzwz_ (3nzw Z:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993378Domain d3nzwz_: 3nzw Z: [182694]
    Other proteins in same PDB: d3nzw1_, d3nzwa_, d3nzwc2, d3nzwe_, d3nzwf_, d3nzwi_, d3nzwj_, d3nzwm_, d3nzwo_, d3nzwq2, d3nzws_, d3nzwt_, d3nzww_, d3nzwx_
    automated match to d1g0ul_
    complexed with mes

Details for d3nzwz_

PDB Entry: 3nzw (more details), 2.5 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with 2b
PDB Compounds: (Z:) Proteasome component C5

SCOPe Domain Sequences for d3nzwz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzwz_ d.153.1.4 (Z:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d3nzwz_:

Click to download the PDB-style file with coordinates for d3nzwz_.
(The format of our PDB-style files is described here.)

Timeline for d3nzwz_: