SCOPe 2.08: Domain d3nzwp_: 3nzw P:

Lineage for d3nzwp_ (3nzw P:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d3nzwp_: 3nzw P: [182688]
   Other proteins in same PDB: d3nzw1_, d3nzwa_, d3nzwc2, d3nzwe_, d3nzwf_, d3nzwi_, d3nzwj_, d3nzwm_, d3nzwo_, d3nzwq2, d3nzws_, d3nzwt_, d3nzww_, d3nzwx_
   automated match to d1g65b_
   complexed with mes

Details for d3nzwp_

PDB Entry: 3nzw, 2.5 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with 2b

PDB Compounds: (P:) Proteasome component Y13

SCOPe Domain Sequences for d3nzwp_:

Sequence; same for both SEQRES and ATOM records:

>d3nzwp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d3nzwp_:

• d3nzwp_ first appeared in SCOPe 2.01
  
• d3nzwp_ appears in SCOPe 2.07