Lineage for d3nj3b1 (3nj3 B:18-341)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094316Protein automated matches [190057] (26 species)
    not a true protein
  7. 2094459Species Thermotoga petrophila [TaxId:390874] [189941] (2 PDB entries)
  8. 2094463Domain d3nj3b1: 3nj3 B:18-341 [182334]
    Other proteins in same PDB: d3nj3a2, d3nj3b2
    automated match to d1vbra1
    complexed with act, so4, xyp

Details for d3nj3b1

PDB Entry: 3nj3 (more details), 1.88 Å

PDB Description: crystal structure of xylanase 10b from thermotoga petrophila rku-1 in complex with xylobiose
PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3nj3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nj3b1 c.1.8.3 (B:18-341) automated matches {Thermotoga petrophila [TaxId: 390874]}
qnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihperd
rynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvsh
fkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndysiee
inaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitem
dvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgygkal
lfdenynpkpcyyaikevlekkie

SCOPe Domain Coordinates for d3nj3b1:

Click to download the PDB-style file with coordinates for d3nj3b1.
(The format of our PDB-style files is described here.)

Timeline for d3nj3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nj3b2