![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein automated matches [190057] (26 species) not a true protein |
![]() | Species Thermotoga petrophila [TaxId:390874] [189941] (2 PDB entries) |
![]() | Domain d3nj3a1: 3nj3 A:18-341 [182333] Other proteins in same PDB: d3nj3a2, d3nj3b2 automated match to d1vbra1 complexed with act, so4, xyp |
PDB Entry: 3nj3 (more details), 1.88 Å
SCOPe Domain Sequences for d3nj3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nj3a1 c.1.8.3 (A:18-341) automated matches {Thermotoga petrophila [TaxId: 390874]} qnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihperd rynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvsh fkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndysiee inaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitem dvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgygkal lfdenynpkpcyyaikevlekkie
Timeline for d3nj3a1: