SCOPe 2.05: Domain d3nj3a_: 3nj3 A:

Lineage for d3nj3a_ (3nj3 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (21 species)
   not a true protein

7. Species Thermotoga petrophila [TaxId:390874] [189941] (2 PDB entries)

8. Domain d3nj3a_: 3nj3 A: [182333]
   automated match to d1vbra1
   complexed with act, so4, xyp

Details for d3nj3a_

PDB Entry: 3nj3, 1.88 Å

PDB Description: crystal structure of xylanase 10b from thermotoga petrophila rku-1 in complex with xylobiose

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3nj3a_:

Sequence; same for both SEQRES and ATOM records:

>d3nj3a_ c.1.8.3 (A:) automated matches {Thermotoga petrophila [TaxId: 390874]}
ghmqnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihp
erdrynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktv
vshfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndys
ieeinaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyi
temdvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgyg
kallfdenynpkpcyyaikevlekkie

Timeline for d3nj3a_:

• d3nj3a_ first appeared in SCOPe 2.01
  
• d3nj3a_ appears in SCOPe 2.04
  
• d3nj3a_ is called d3nj3a1 in SCOPe 2.06
  
• d3nj3a_ appears in the current release, SCOPe 2.08, called d3nj3a1