Lineage for d3nj3a_ (3nj3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569823Protein automated matches [190057] (20 species)
    not a true protein
  7. 1569915Species Thermotoga petrophila [TaxId:390874] [189941] (2 PDB entries)
  8. 1569918Domain d3nj3a_: 3nj3 A: [182333]
    automated match to d1vbra1
    complexed with act, so4, xyp

Details for d3nj3a_

PDB Entry: 3nj3 (more details), 1.88 Å

PDB Description: crystal structure of xylanase 10b from thermotoga petrophila rku-1 in complex with xylobiose
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3nj3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nj3a_ c.1.8.3 (A:) automated matches {Thermotoga petrophila [TaxId: 390874]}
ghmqnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihp
erdrynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktv
vshfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndys
ieeinaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyi
temdvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgyg
kallfdenynpkpcyyaikevlekkie

SCOPe Domain Coordinates for d3nj3a_:

Click to download the PDB-style file with coordinates for d3nj3a_.
(The format of our PDB-style files is described here.)

Timeline for d3nj3a_: