SCOPe 2.08: Domain d3nj3b1: 3nj3 B:18-341

Lineage for d3nj3b1 (3nj3 B:18-341)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (28 species)
   not a true protein

7. Species Thermotoga petrophila [TaxId:390874] [189941] (2 PDB entries)

8. Domain d3nj3b1: 3nj3 B:18-341 [182334]
   Other proteins in same PDB: d3nj3a2, d3nj3b2
   automated match to d1vbra1
   complexed with act, so4

Details for d3nj3b1

PDB Entry: 3nj3, 1.88 Å

PDB Description: crystal structure of xylanase 10b from thermotoga petrophila rku-1 in complex with xylobiose

PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3nj3b1:

Sequence; same for both SEQRES and ATOM records:

>d3nj3b1 c.1.8.3 (B:18-341) automated matches {Thermotoga petrophila [TaxId: 390874]}
qnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihperd
rynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvsh
fkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndysiee
inaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitem
dvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgygkal
lfdenynpkpcyyaikevlekkie

Timeline for d3nj3b1:

• d3nj3b1 first appeared in SCOPe 2.01, called d3nj3b_
  
• d3nj3b1 appears in SCOPe 2.07